LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP001499

Record overview

LMPD IDLMP001499
Gene ID16592
SpeciesMus musculus(Mouse)
Gene Namefatty acid binding protein 5, epidermal
Gene SymbolFabp5
SynonymsE-FABP; Fabpe; Klbp; PA-FABP; mal1
Alternate namesfatty acid-binding protein, epidermal; keratinocyte lipid-binding protein; epithelial fatty acid-binding protein; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog
Chromosome3
Map Location3 A1-A3|3
SummaryThe protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. In humans this gene has been associated with psoriasis and type 2 diabetes. In mouse deficiency of this gene in combination with a deficiency in Fabp4 confers protection against atherosclerosis, diet-induced obesity, insulin resistance and experimental autoimmune encephalomyelitis (the mouse model for multiple sclerosis). Alternative splicing results in multiple transcript variants that encode different protein isoforms. The mouse genome contains many pseudogenes similar to this locus. [provided by RefSeq, Jan 2013]
OrthologsView orthologs and multiple alignments for Fabp5

Proteins

fatty acid-binding protein, epidermal isoform 1
Refseq ID:NP_034764
Protein GI:6754450
UniProt ID:Q05816
mRNA ID:NM_010634
Length:135
RefSeq Status:REVIEWED
MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQW
DGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ