LMPD Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
LMP000352

Record overview

LMPD IDLMP000352
Gene ID5564
SpeciesHomo sapiens (Human)
Gene Nameprotein kinase, AMP-activated, beta 1 non-catalytic subunit
Gene SymbolPRKAB1
SynonymsAMPK; HAMPKb
Alternate names5'-AMP-activated protein kinase subunit beta-1;,AMPKb; AMPK beta 1; AMPK beta -1 chain; AMPK subunit beta-1; AMP-activated protein kinase beta subunit', "5'-AMP-activated protein kinase beta-1 subunit;,protein kinase, AMP-activated, noncatalytic, beta-1
Chromosome12
Map Location12q24.1-q24.3
SummaryThe protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for PRKAB1

Proteins

5'-AMP-activated protein kinase subunit beta-1
Refseq ID:NP_006244
Protein GI:19923359
UniProt ID:Q9Y478
mRNA ID:NM_006253
Length:270
RefSeq Status:REVIEWED
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
SKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERF
RAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI